(data stored in ACNUC7421 zone)

EMBL: CP000667.PE457

CP000667.PE457       Location/Qualifiers
FT   CDS             519272..520117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0457"
FT                   /product="transcription factor jumonji, jmjC domain
FT                   protein"
FT                   /note="SMART: transcription factor jumonji, jmjC domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52942"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:A4X242"
FT                   /protein_id="ABP52942.1"
FT                   /translation="MTVPQEAGVPVARMTFEEFQALGPGGLFKTDVPVVISLPESVRGL
FT                   GREGVAARLADMTVTLFTEPGDKNHPGRWETRDITLRDFFADERHLTESDTWHRVVSNI
FT                   RNSPADVNAVVGFDAEGFFGYGSSLYAANLWISHRGVFTKNHFDEFENFNIALEGRKRF
FT                   IIAPPGSRDYYPRSMLRGFGDKSQVFDLDNVDLGRYPRVAPKLAQRRDFVLEPGHMLYL
FT                   PLGWWHQAESLDPININVNFWLKSKKILRRPHVLGVALYTYAYRRVKGVYSYQPTEVSS
FT                   "
     MTVPQEAGVP VARMTFEEFQ ALGPGGLFKT DVPVVISLPE SVRGLGREGV AARLADMTVT        60
     LFTEPGDKNH PGRWETRDIT LRDFFADERH LTESDTWHRV VSNIRNSPAD VNAVVGFDAE       120
     GFFGYGSSLY AANLWISHRG VFTKNHFDEF ENFNIALEGR KRFIIAPPGS RDYYPRSMLR       180
     GFGDKSQVFD LDNVDLGRYP RVAPKLAQRR DFVLEPGHML YLPLGWWHQA ESLDPININV       240
     NFWLKSKKIL RRPHVLGVAL YTYAYRRVKG VYSYQPTEVS S                           281
//

If you have problems or comments...

PBIL Back to PBIL home page