(data stored in ACNUC7421 zone)

EMBL: CP000667.PE462

CP000667.PE462       Location/Qualifiers
FT   CDS             524576..525067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0462"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52947"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4X247"
FT                   /protein_id="ABP52947.1"
FT                   /translation="MTLRRVSDHEYVEEHGGDYEDFEPGMVIRHWPGRTLSEADNTWLT
FT                   LLTMNQHPLHFDQHYAAGVEYGRVLVNSGITLCLIGGMTVQALSARAVANLGWDKVRLK
FT                   EPVFVGDTLYATSRILHKRLSRSRPGNGIVTVETTGTKANGEQVIVFERSFLVRCRQAG
FT                   "
     MTLRRVSDHE YVEEHGGDYE DFEPGMVIRH WPGRTLSEAD NTWLTLLTMN QHPLHFDQHY        60
     AAGVEYGRVL VNSGITLCLI GGMTVQALSA RAVANLGWDK VRLKEPVFVG DTLYATSRIL       120
     HKRLSRSRPG NGIVTVETTG TKANGEQVIV FERSFLVRCR QAG                         163
//

If you have problems or comments...

PBIL Back to PBIL home page