(data stored in ACNUC7421 zone)

EMBL: CP000667.PE464

CP000667.PE464       Location/Qualifiers
FT   CDS             526703..526909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52949"
FT                   /db_xref="UniProtKB/TrEMBL:A4X249"
FT                   /protein_id="ABP52949.1"
FT                   /translation="MTGARSRGLVLLARGRSTLHRHPGRTSPNSVTDAAANKHIGNIFS
FT                   KRDLPVTTDGHPRVLAVLAYLRS"
     MTGARSRGLV LLARGRSTLH RHPGRTSPNS VTDAAANKHI GNIFSKRDLP VTTDGHPRVL        60
     AVLAYLRS                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page