(data stored in ACNUC7421 zone)

EMBL: CP000667.PE466

CP000667.PE466       Location/Qualifiers
FT   CDS             complement(527646..529202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52951"
FT                   /db_xref="GOA:A4X251"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/TrEMBL:A4X251"
FT                   /protein_id="ABP52951.1"
FT                   /translation="MTHPGAARPGEPGWRHHPDVAAQQARQLPPEQRGAAGQQADAPTP
FT                   APPVSRAGRGPGHAWAAHRAPGRATTNTVYTPEGAVAAQPNAAVQANAAVQANTATLSA
FT                   AVAPTASPLPAASASSATAATAAGVPPTPDVPAARRVRPYRPPLQVGGVTVAQLVAWQF
FT                   GAAAMLAATRHSVALTAVVAVVTVLVLAPTAIRFRGRWLHQWMPVWWGFRRRHRQLPAV
FT                   DTDPARHLLAQLGHGVELETVEIDDQPVVLLTHPAGLSVVFDVDPTEGALLMSAPQALP
FT                   SPAALLPPADGKAPPVVVQLLIQVTPTPRARPGAAAVDRAYRELTNGDVPASRQAWVVL
FT                   QAARTPDFHADRDLLPTLTGAIRRTRRLLRQERVTARMLNRDEVLAAVTALTHLTDAAP
FT                   GGVGEQPLARESWRAWSTLGARQSCHRLLDWPSRRWEVDSLLRGLPAAGGVVSIAASRT
FT                   DDDLAVEAAFRLLGTDPAGLAAADQALHEAVRRHGGRLQRLDGEHAHGVAATLPLGGFL
FT                   R"
     MTHPGAARPG EPGWRHHPDV AAQQARQLPP EQRGAAGQQA DAPTPAPPVS RAGRGPGHAW        60
     AAHRAPGRAT TNTVYTPEGA VAAQPNAAVQ ANAAVQANTA TLSAAVAPTA SPLPAASASS       120
     ATAATAAGVP PTPDVPAARR VRPYRPPLQV GGVTVAQLVA WQFGAAAMLA ATRHSVALTA       180
     VVAVVTVLVL APTAIRFRGR WLHQWMPVWW GFRRRHRQLP AVDTDPARHL LAQLGHGVEL       240
     ETVEIDDQPV VLLTHPAGLS VVFDVDPTEG ALLMSAPQAL PSPAALLPPA DGKAPPVVVQ       300
     LLIQVTPTPR ARPGAAAVDR AYRELTNGDV PASRQAWVVL QAARTPDFHA DRDLLPTLTG       360
     AIRRTRRLLR QERVTARMLN RDEVLAAVTA LTHLTDAAPG GVGEQPLARE SWRAWSTLGA       420
     RQSCHRLLDW PSRRWEVDSL LRGLPAAGGV VSIAASRTDD DLAVEAAFRL LGTDPAGLAA       480
     ADQALHEAVR RHGGRLQRLD GEHAHGVAAT LPLGGFLR                               518
//

If you have problems or comments...

PBIL Back to PBIL home page