(data stored in ACNUC7421 zone)

EMBL: CP000667.PE468

CP000667.PE468       Location/Qualifiers
FT   CDS             531153..531536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52953"
FT                   /db_xref="InterPro:IPR025968"
FT                   /db_xref="UniProtKB/TrEMBL:A4X253"
FT                   /protein_id="ABP52953.1"
FT                   /translation="MAAPRMLPLTAGALLVNGTVHTHTSVRGDLAPNLHPVIRRFLDEL
FT                   PSGQRERFAGWCAEVVLLSDRLYEAEADGGSISPTQARSLLWGANVWVTRIREEGDPRD
FT                   EEQQPPCRSCAALLDWLGVEGLA"
     MAAPRMLPLT AGALLVNGTV HTHTSVRGDL APNLHPVIRR FLDELPSGQR ERFAGWCAEV        60
     VLLSDRLYEA EADGGSISPT QARSLLWGAN VWVTRIREEG DPRDEEQQPP CRSCAALLDW       120
     LGVEGLA                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page