(data stored in ACNUC7421 zone)

EMBL: CP000667.PE47

CP000667.PE47        Location/Qualifiers
FT   CDS             54898..56286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0047"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52532"
FT                   /db_xref="GOA:A4X0Y2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y2"
FT                   /protein_id="ABP52532.1"
FT                   /translation="MLSSGVKLGNRYRLDERIASGGMGDVWRGTDEVLGRTVAVKSLLP
FT                   ALLDDPDFAERFRGEARTMATINHPGVVDIYDFGSDQQIAFLVMEYVEGDALSATLNRV
FT                   GRLTSARTMALVAQAADALHAAHLEGIVHRDVKPGNLLVRPNGTLVLTDFGIARSDLVA
FT                   QLTAAGSVLGTASYISPEQATGAVATPSSDVYALGVVAYQCLSGRRPFEGDNPLDIALR
FT                   HVRDTPRALPADIPSQVRAVVERAMAKDPADRWPSAAALAGVTRQLKAQLSQAARSVGQ
FT                   ASPVSAVPGRVSPVSAAPASPAPGRASVVSAVPVAPGRARVPSPATALPPQVSRSPVAP
FT                   QPFHPPAPRPQAGWSPVAAVPPASARPGRPPMSAPPPRPSRFGRGLLILLLAVLVVTCF
FT                   GMVSSVWHEAYTGSSGRPVQSTGMSGELRHDGRDDSDRTSYRQLQLPSTGDDETTTSEG
FT                   RQTR"
     MLSSGVKLGN RYRLDERIAS GGMGDVWRGT DEVLGRTVAV KSLLPALLDD PDFAERFRGE        60
     ARTMATINHP GVVDIYDFGS DQQIAFLVME YVEGDALSAT LNRVGRLTSA RTMALVAQAA       120
     DALHAAHLEG IVHRDVKPGN LLVRPNGTLV LTDFGIARSD LVAQLTAAGS VLGTASYISP       180
     EQATGAVATP SSDVYALGVV AYQCLSGRRP FEGDNPLDIA LRHVRDTPRA LPADIPSQVR       240
     AVVERAMAKD PADRWPSAAA LAGVTRQLKA QLSQAARSVG QASPVSAVPG RVSPVSAAPA       300
     SPAPGRASVV SAVPVAPGRA RVPSPATALP PQVSRSPVAP QPFHPPAPRP QAGWSPVAAV       360
     PPASARPGRP PMSAPPPRPS RFGRGLLILL LAVLVVTCFG MVSSVWHEAY TGSSGRPVQS       420
     TGMSGELRHD GRDDSDRTSY RQLQLPSTGD DETTTSEGRQ TR                          462
//

If you have problems or comments...

PBIL Back to PBIL home page