(data stored in ACNUC7421 zone)

EMBL: CP000667.PE470

CP000667.PE470       Location/Qualifiers
FT   CDS             532012..533292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52955"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="UniProtKB/TrEMBL:A4X255"
FT                   /protein_id="ABP52955.1"
FT                   /translation="MVADWRPATPLEETLLAAAVAGERSSFLAALATGQLLLPVSPEAT
FT                   AGAAPMPWPTGRYDGGTYVIAFTSPEAIAACLPGQSVNYRALGIQDLASDWPDDGWLLA
FT                   VNAGLPVGTRITADELRVVAGPALEAERELRHAIDQQDPDALMAALLRTELLLPIRPGG
FT                   SESRDLSDPEFPWWCLPDEQGQPGLPIFTGEARLRQALGDHDVITVSSLQLAEQWPDPT
FT                   WQLLLNPGTPLAAALPGSALRNLCDWLGQLRQVVTDAAEEERQRREPTAGVEPAMPGVP
FT                   ASRTAPEEDDAADEPDPDLPIRLQLVIPHQYLSSYLEDGYQRAAGLVHAWGGPGRDTPA
FT                   RIYRRLGLLGEGSPFVESDEWVAVLRWDPDEATPEEWGQGQPRMESLVVSDGTGLHCLH
FT                   RDGRDELLACFDAATARWLPAGASAGS"
     MVADWRPATP LEETLLAAAV AGERSSFLAA LATGQLLLPV SPEATAGAAP MPWPTGRYDG        60
     GTYVIAFTSP EAIAACLPGQ SVNYRALGIQ DLASDWPDDG WLLAVNAGLP VGTRITADEL       120
     RVVAGPALEA ERELRHAIDQ QDPDALMAAL LRTELLLPIR PGGSESRDLS DPEFPWWCLP       180
     DEQGQPGLPI FTGEARLRQA LGDHDVITVS SLQLAEQWPD PTWQLLLNPG TPLAAALPGS       240
     ALRNLCDWLG QLRQVVTDAA EEERQRREPT AGVEPAMPGV PASRTAPEED DAADEPDPDL       300
     PIRLQLVIPH QYLSSYLEDG YQRAAGLVHA WGGPGRDTPA RIYRRLGLLG EGSPFVESDE       360
     WVAVLRWDPD EATPEEWGQG QPRMESLVVS DGTGLHCLHR DGRDELLACF DAATARWLPA       420
     GASAGS                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page