(data stored in ACNUC7421 zone)

EMBL: CP000667.PE472

CP000667.PE472       Location/Qualifiers
FT   CDS             complement(534703..536283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52957"
FT                   /db_xref="UniProtKB/TrEMBL:A4X257"
FT                   /protein_id="ABP52957.1"
FT                   /translation="MTDQYYGWTPTLAGFAGGGDDYVADQAAQSTPYEPTQWDGVTIEQ
FT                   MWEYARRESDERTVALAETWRRTSILLQSTRENLKRHADGLRAKWRSPAGELFMSKVGA
FT                   ALYSLDEWKDVADKNANGLEQIASKIAQTQRDMRELWLTYQAEQKHQAQKRKADEGIQF
FT                   GDIFGLNNGKSYTEVQKEFHERAKNIVKPLAELYIDVYISNISRGGKYKGPTNIAEYNP
FT                   GQSPRPERPSAPIRPRPPAPNLLGGRPEMLARLDVTPPPSSPELSDGIGLAGGTVTAPS
FT                   PTPGPPPAATPPISPTPTPAPAPLPPPVLRGVSSPGTAQPTTPSTTRPSNAPRTTLPGA
FT                   NNPDARGPAPNRPAPPNTGKPGGSPAHRGPTPNQATLPGNTGTGRPPAGSIPPRPTPPP
FT                   PNLSGKHSTSRAASGPRTSSPSVGRPAPPPTTGRPTPPNGGSPLTGRTAAGGTRPAPTT
FT                   GPAPSLGGRRGAPTTPRPPARARPEETENWKYGEGDDELWVTDPAPAGTIDAPAENQPR
FT                   HHGKALGQG"
     MTDQYYGWTP TLAGFAGGGD DYVADQAAQS TPYEPTQWDG VTIEQMWEYA RRESDERTVA        60
     LAETWRRTSI LLQSTRENLK RHADGLRAKW RSPAGELFMS KVGAALYSLD EWKDVADKNA       120
     NGLEQIASKI AQTQRDMREL WLTYQAEQKH QAQKRKADEG IQFGDIFGLN NGKSYTEVQK       180
     EFHERAKNIV KPLAELYIDV YISNISRGGK YKGPTNIAEY NPGQSPRPER PSAPIRPRPP       240
     APNLLGGRPE MLARLDVTPP PSSPELSDGI GLAGGTVTAP SPTPGPPPAA TPPISPTPTP       300
     APAPLPPPVL RGVSSPGTAQ PTTPSTTRPS NAPRTTLPGA NNPDARGPAP NRPAPPNTGK       360
     PGGSPAHRGP TPNQATLPGN TGTGRPPAGS IPPRPTPPPP NLSGKHSTSR AASGPRTSSP       420
     SVGRPAPPPT TGRPTPPNGG SPLTGRTAAG GTRPAPTTGP APSLGGRRGA PTTPRPPARA       480
     RPEETENWKY GEGDDELWVT DPAPAGTIDA PAENQPRHHG KALGQG                      526
//

If you have problems or comments...

PBIL Back to PBIL home page