(data stored in ACNUC7421 zone)

EMBL: CP000667.PE476

CP000667.PE476       Location/Qualifiers
FT   CDS             complement(542592..543353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52961"
FT                   /db_xref="InterPro:IPR025850"
FT                   /db_xref="UniProtKB/TrEMBL:A4X261"
FT                   /protein_id="ABP52961.1"
FT                   /translation="MISRDEALARARRWAAAGRPGPPPEVDFYEFDLGFVASRREPLRF
FT                   APDGTPKPPSATGQPTVVIDRGTGRLSSWPPLSNQEIAEWYGKYHAAEGRFPPDVREVL
FT                   DQAGWFPGRDMTAAVDLWLARFADELAGLECFPAVRAALIEFGGLILPQLGRSGEPGAG
FT                   FASGIQPTRTGGVLADCSEIFAEEFNNPVFPLGNNADGPSELVMDAQGRVFQLHWADDF
FT                   FIGPDIDTAIIALIRGGRMPAASDLTWRTDN"
     MISRDEALAR ARRWAAAGRP GPPPEVDFYE FDLGFVASRR EPLRFAPDGT PKPPSATGQP        60
     TVVIDRGTGR LSSWPPLSNQ EIAEWYGKYH AAEGRFPPDV REVLDQAGWF PGRDMTAAVD       120
     LWLARFADEL AGLECFPAVR AALIEFGGLI LPQLGRSGEP GAGFASGIQP TRTGGVLADC       180
     SEIFAEEFNN PVFPLGNNAD GPSELVMDAQ GRVFQLHWAD DFFIGPDIDT AIIALIRGGR       240
     MPAASDLTWR TDN                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page