(data stored in ACNUC7421 zone)

EMBL: CP000667.PE477

CP000667.PE477       Location/Qualifiers
FT   CDS             543491..544930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0477"
FT                   /product="protein of unknown function DUF690"
FT                   /note="PFAM: protein of unknown function DUF690"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52962"
FT                   /db_xref="GOA:A4X262"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:A4X262"
FT                   /protein_id="ABP52962.1"
FT                   /translation="MPSRRDQVQSYQFFVQRMTSALVAREPDPATAAPFRRLGGAGFAS
FT                   IMVAVLCLAAVGVYGLLRPGGATKWKEESAVILEKETGSRYIYQEDRLYPVINYSSALL
FT                   ALGSAAQTVSVSRNSLVGTPRGTRIGIRDAPDALPDPKRLLSGPWTLCTQLAHDSAGGA
FT                   VATTVLTVGAAPSGGREMDEAALLVRDTATNRLHLIWQDHRYEIRDENVVLEGLTMTTE
FT                   PVVEVGGAWLNALPAGESIGISEVVDRGEPSRALQDARIGQIFVVESQNGGRQYYLAER
FT                   DQLRSLTQLQAEVLLADPKATRAYPDGSPPEPISLPAGVAASAQKAPPVAEGSHRAPAE
FT                   RPEIVQLRGDEPAVCAVYQPGQSEPTLLLEGRVRPEEGLLRTAEQTSAGIPLADRVVVE
FT                   PGHGVLVEAMPAPEAPTGALSLVTDLGYRYPLPSNEVAGLLGYGGVQPVEMPASLVVRL
FT                   PAGPVLDPTAAKQALGPELPQ"
     MPSRRDQVQS YQFFVQRMTS ALVAREPDPA TAAPFRRLGG AGFASIMVAV LCLAAVGVYG        60
     LLRPGGATKW KEESAVILEK ETGSRYIYQE DRLYPVINYS SALLALGSAA QTVSVSRNSL       120
     VGTPRGTRIG IRDAPDALPD PKRLLSGPWT LCTQLAHDSA GGAVATTVLT VGAAPSGGRE       180
     MDEAALLVRD TATNRLHLIW QDHRYEIRDE NVVLEGLTMT TEPVVEVGGA WLNALPAGES       240
     IGISEVVDRG EPSRALQDAR IGQIFVVESQ NGGRQYYLAE RDQLRSLTQL QAEVLLADPK       300
     ATRAYPDGSP PEPISLPAGV AASAQKAPPV AEGSHRAPAE RPEIVQLRGD EPAVCAVYQP       360
     GQSEPTLLLE GRVRPEEGLL RTAEQTSAGI PLADRVVVEP GHGVLVEAMP APEAPTGALS       420
     LVTDLGYRYP LPSNEVAGLL GYGGVQPVEM PASLVVRLPA GPVLDPTAAK QALGPELPQ        479
//

If you have problems or comments...

PBIL Back to PBIL home page