(data stored in ACNUC7421 zone)

EMBL: CP000667.PE48

CP000667.PE48        Location/Qualifiers
FT   CDS             56283..58112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0048"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; PASTA domain containing
FT                   protein; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52533"
FT                   /db_xref="GOA:A4X0Y3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y3"
FT                   /protein_id="ABP52533.1"
FT                   /translation="MTAQARLLGGRYQVGELIGYGGMAEVHRGRDLRLGRDVAIKMLRA
FT                   DLARDATFQMRFRREAQNAASLNHPAIVAVYDTGEEQAPTGETLPFIVMEFVGGRTLKE
FT                   VLGGEGRFQPRRALEICADMCAALEFSHRHQIIHRDIKPGNVMLTQTGQVKVMDFGIAR
FT                   ALASGATTMTQTSAVIGTAQYLSPEQARGESVDARSDVYAAGCVLFELLCGHPPFVGDS
FT                   PVSVAYQHVREAPPTPSDLNPEVPPAVDAIILKALSKNPLNRYQSAGEMRADLLRAAAG
FT                   RPVMATPVLREEETTQLAPAGAGYPAGAPGPRTQQIPARVGDPRRRRASSWLIATFAAL
FT                   GVLAVVALVVAELMSSPPEEKASVPRVTGLTEAEAIDKIEQANLAAEAGPAIRDNDCNK
FT                   GEVTNQDPSPGEELNPADVVTVFICAGPATVTIPDTLVGSTFDNAKRQLENAGFEVDRE
FT                   EVDDAAPKNTVLGVTPDEGSQAAEGEVVTLTVSKGNIGTVPNVVNSYVDDAERELEDAG
FT                   YEVNIKEGQPVPPGEQGRVTNQNPSPNTPLRKGKTVTITVTVLEEPTDSPTPEPSESPT
FT                   SEPPDEPPDNGGEGGGGGGLPLPTTPPARLPTR"
     MTAQARLLGG RYQVGELIGY GGMAEVHRGR DLRLGRDVAI KMLRADLARD ATFQMRFRRE        60
     AQNAASLNHP AIVAVYDTGE EQAPTGETLP FIVMEFVGGR TLKEVLGGEG RFQPRRALEI       120
     CADMCAALEF SHRHQIIHRD IKPGNVMLTQ TGQVKVMDFG IARALASGAT TMTQTSAVIG       180
     TAQYLSPEQA RGESVDARSD VYAAGCVLFE LLCGHPPFVG DSPVSVAYQH VREAPPTPSD       240
     LNPEVPPAVD AIILKALSKN PLNRYQSAGE MRADLLRAAA GRPVMATPVL REEETTQLAP       300
     AGAGYPAGAP GPRTQQIPAR VGDPRRRRAS SWLIATFAAL GVLAVVALVV AELMSSPPEE       360
     KASVPRVTGL TEAEAIDKIE QANLAAEAGP AIRDNDCNKG EVTNQDPSPG EELNPADVVT       420
     VFICAGPATV TIPDTLVGST FDNAKRQLEN AGFEVDREEV DDAAPKNTVL GVTPDEGSQA       480
     AEGEVVTLTV SKGNIGTVPN VVNSYVDDAE RELEDAGYEV NIKEGQPVPP GEQGRVTNQN       540
     PSPNTPLRKG KTVTITVTVL EEPTDSPTPE PSESPTSEPP DEPPDNGGEG GGGGGLPLPT       600
     TPPARLPTR                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page