(data stored in ACNUC7421 zone)

EMBL: CP000667.PE481

CP000667.PE481       Location/Qualifiers
FT   CDS             547220..547657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52966"
FT                   /db_xref="GOA:A4X266"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A4X266"
FT                   /protein_id="ABP52966.1"
FT                   /translation="MDRRWQHMDVQGEDAMDIQALRARADELMNQFERMRSGVGGLQQR
FT                   LKEVNATVTSDDGFVTVTVGPRGHVAKVEFDPRLYRRPNSKELSATVTATIQRATEKAL
FT                   AEVEELLRPFVPDSQFQAYLDHDLTGIFGQLERELPREGDR"
     MDRRWQHMDV QGEDAMDIQA LRARADELMN QFERMRSGVG GLQQRLKEVN ATVTSDDGFV        60
     TVTVGPRGHV AKVEFDPRLY RRPNSKELSA TVTATIQRAT EKALAEVEEL LRPFVPDSQF       120
     QAYLDHDLTG IFGQLERELP REGDR                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page