(data stored in ACNUC7421 zone)

EMBL: CP000667.PE488

CP000667.PE488       Location/Qualifiers
FT   CDS             complement(563815..564069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52973"
FT                   /db_xref="UniProtKB/TrEMBL:A4X273"
FT                   /protein_id="ABP52973.1"
FT                   /translation="MRRLSVNGLSGPRKINYRLSRRADLTTLAAALLEAGGVAVDDFCS
FT                   RTWTAAEIEADTMINGDRFGEGSVRGEAFSSRRSRRAPA"
     MRRLSVNGLS GPRKINYRLS RRADLTTLAA ALLEAGGVAV DDFCSRTWTA AEIEADTMIN        60
     GDRFGEGSVR GEAFSSRRSR RAPA                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page