(data stored in ACNUC7421 zone)

EMBL: CP000667.PE489

CP000667.PE489       Location/Qualifiers
FT   CDS             564615..565061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52974"
FT                   /db_xref="UniProtKB/TrEMBL:A4X274"
FT                   /protein_id="ABP52974.1"
FT                   /translation="MDIEALLPRARTPRDYLDLVTDPRVDQDGLHTLARSPYSFVRLAI
FT                   AKDIRTSPATLTELLLGEFDQWDRNYLLRLVAQHPQADRVVLLKVLHATEVLLRQSGAR
FT                   PYGVAIALASRHELAPHEVRRAHRLPGASRRMRRGVERALARRQ"
     MDIEALLPRA RTPRDYLDLV TDPRVDQDGL HTLARSPYSF VRLAIAKDIR TSPATLTELL        60
     LGEFDQWDRN YLLRLVAQHP QADRVVLLKV LHATEVLLRQ SGARPYGVAI ALASRHELAP       120
     HEVRRAHRLP GASRRMRRGV ERALARRQ                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page