(data stored in ACNUC7421 zone)

EMBL: CP000667.PE490

CP000667.PE490       Location/Qualifiers
FT   CDS             complement(565585..566049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52975"
FT                   /db_xref="InterPro:IPR025355"
FT                   /db_xref="UniProtKB/TrEMBL:A4X275"
FT                   /protein_id="ABP52975.1"
FT                   /translation="MPGAAALPCTRYGESKGSIMGAWGPGPFDNDTACDWGYELDDAVR
FT                   ADRVAVLRSALIAAADQSGHLGHTEAAEAVGAAAIVAAFQPGGPPLDPIYSPDCLRADG
FT                   LDVPPELVDLAARALDRVMGGDSEWRELWAEAGRLDDVTAVLAPIRASLT"
     MPGAAALPCT RYGESKGSIM GAWGPGPFDN DTACDWGYEL DDAVRADRVA VLRSALIAAA        60
     DQSGHLGHTE AAEAVGAAAI VAAFQPGGPP LDPIYSPDCL RADGLDVPPE LVDLAARALD       120
     RVMGGDSEWR ELWAEAGRLD DVTAVLAPIR ASLT                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page