(data stored in ACNUC7421 zone)

EMBL: CP000667.PE492

CP000667.PE492       Location/Qualifiers
FT   CDS             567472..570363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0492"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   transcriptional activator domain; Tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52977"
FT                   /db_xref="GOA:A4X277"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4X277"
FT                   /protein_id="ABP52977.1"
FT                   /translation="MAGPAVRIRLLGGVEVVDGSGTAVDIGAGKCRALLAALAMQPGRA
FT                   IPDWRLIDLLWGEQPPRTAVRTLQSYIARLRGGLGAGRIVRSGASYRLDVPADAVDVIR
FT                   FGRRVEAGDVAGALAEWTGDPLAGVPVPGLAATVDGLVEQWLGAVEADLTARVDADAAA
FT                   TVGPLTELSARYPFREGLWALLMTALYRVGRQADALTAYRTARQQLVEHLGVEPGPRLR
FT                   RLESAILDQDPRIGGERRSEPVHRLPRRAVRLIGRDGDLDLIGRALDESPVVTLVGPGG
FT                   IGKTALAVAAAQRTRLEHGAWLVDLTEITTDQDVPQAVAAAVRVEEGPGRSLSESIVLS
FT                   LSSLRALLVLDNCEHVADGAARLAQAVADGCPQVRVLATAREPLGLSHGHERLVAVTPL
FT                   PAAGAGADLFAERANALTAAFTTGAAREVIEEICRCLDGLPLAIELAAAQTVSHTPQEI
FT                   RERLDDQLGLLVGGRRTGADRHRTMRATIQWSYRLLTVAEQDLLQRLSVFAGPVDRAGA
FT                   AAVAAGSGLDVNDVLHTLVQRSMVTAEPGRFGQQFRLLEPVRQFAAEHLAAGSAAAPAQ
FT                   AAHTRYVRERVTSLHDQLTGTAEIQGVAHLDELWPNLRVAVDRAFACGDYRLAHDLFRP
FT                   IGTEALRRHRHEIGQWAQRLLEQAPAEDRPRVVAGLIAAGPRYHLRQDPAGFDTLVRQY
FT                   GDPDDPVARHMRANVHDDYAAQIHSAPQALAELRRLGADDLAAHVEVDLGAALVFQGQY
FT                   ARGDTKLTELADRFRSDGPPTLLNWTLMLLGFSAAFQGRRAAADQLFDQAVDVPLPVRT
FT                   HSPNQSVRAQALFRRGDRRAAYQLLRAHVEELLDADNMHGACVVSISFVTMMPAVARFA
FT                   EGARVLAFLDTAGLLDNVAWAAMVADARDELATFAPAFDESTIADQRQALVAIGDTLDD
FT                   LLAEQTSRPDANSIFNLLGGGIDPRRSWEQSLD"
     MAGPAVRIRL LGGVEVVDGS GTAVDIGAGK CRALLAALAM QPGRAIPDWR LIDLLWGEQP        60
     PRTAVRTLQS YIARLRGGLG AGRIVRSGAS YRLDVPADAV DVIRFGRRVE AGDVAGALAE       120
     WTGDPLAGVP VPGLAATVDG LVEQWLGAVE ADLTARVDAD AAATVGPLTE LSARYPFREG       180
     LWALLMTALY RVGRQADALT AYRTARQQLV EHLGVEPGPR LRRLESAILD QDPRIGGERR       240
     SEPVHRLPRR AVRLIGRDGD LDLIGRALDE SPVVTLVGPG GIGKTALAVA AAQRTRLEHG       300
     AWLVDLTEIT TDQDVPQAVA AAVRVEEGPG RSLSESIVLS LSSLRALLVL DNCEHVADGA       360
     ARLAQAVADG CPQVRVLATA REPLGLSHGH ERLVAVTPLP AAGAGADLFA ERANALTAAF       420
     TTGAAREVIE EICRCLDGLP LAIELAAAQT VSHTPQEIRE RLDDQLGLLV GGRRTGADRH       480
     RTMRATIQWS YRLLTVAEQD LLQRLSVFAG PVDRAGAAAV AAGSGLDVND VLHTLVQRSM       540
     VTAEPGRFGQ QFRLLEPVRQ FAAEHLAAGS AAAPAQAAHT RYVRERVTSL HDQLTGTAEI       600
     QGVAHLDELW PNLRVAVDRA FACGDYRLAH DLFRPIGTEA LRRHRHEIGQ WAQRLLEQAP       660
     AEDRPRVVAG LIAAGPRYHL RQDPAGFDTL VRQYGDPDDP VARHMRANVH DDYAAQIHSA       720
     PQALAELRRL GADDLAAHVE VDLGAALVFQ GQYARGDTKL TELADRFRSD GPPTLLNWTL       780
     MLLGFSAAFQ GRRAAADQLF DQAVDVPLPV RTHSPNQSVR AQALFRRGDR RAAYQLLRAH       840
     VEELLDADNM HGACVVSISF VTMMPAVARF AEGARVLAFL DTAGLLDNVA WAAMVADARD       900
     ELATFAPAFD ESTIADQRQA LVAIGDTLDD LLAEQTSRPD ANSIFNLLGG GIDPRRSWEQ       960
     SLD                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page