(data stored in ACNUC7421 zone)

EMBL: CP000667.PE495

CP000667.PE495       Location/Qualifiers
FT   CDS             complement(573774..574613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0495"
FT                   /product="MIP family channel protein"
FT                   /note="TIGRFAM: MIP family channel protein; PFAM: major
FT                   intrinsic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52980"
FT                   /db_xref="GOA:A4X280"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A4X280"
FT                   /protein_id="ABP52980.1"
FT                   /translation="MTQRVRAPGLLGELAAEFAGTAILILFGVGVVAQVNAGGTGEFDS
FT                   IAWAWGLGVALGIYVAGRISGAHLNPAVTLALAVFKGFSWRKVMPYALAQTAGAFVAAL
FT                   IIRWNYSEVLQRFDPGLTSKSQGVFSTLPGAGITEWGALRDQIIGTAILLFLILAVTDA
FT                   RNSLPGANLAPLIVGLIVVAIGMAFAVNAGYAINPARDFGPRLASFLTGYETAFLDPSG
FT                   YPYFWVPIVGPLAGGVIGAGLYELFVGRFLPSDEPQPGANGSETATETAAVSERARL"
     MTQRVRAPGL LGELAAEFAG TAILILFGVG VVAQVNAGGT GEFDSIAWAW GLGVALGIYV        60
     AGRISGAHLN PAVTLALAVF KGFSWRKVMP YALAQTAGAF VAALIIRWNY SEVLQRFDPG       120
     LTSKSQGVFS TLPGAGITEW GALRDQIIGT AILLFLILAV TDARNSLPGA NLAPLIVGLI       180
     VVAIGMAFAV NAGYAINPAR DFGPRLASFL TGYETAFLDP SGYPYFWVPI VGPLAGGVIG       240
     AGLYELFVGR FLPSDEPQPG ANGSETATET AAVSERARL                              279
//

If you have problems or comments...

PBIL Back to PBIL home page