(data stored in ACNUC7421 zone)

EMBL: CP000667.PE496

CP000667.PE496       Location/Qualifiers
FT   CDS             574702..575565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0496"
FT                   /product="regulatory protein, IclR"
FT                   /note="PFAM: regulatory protein, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52981"
FT                   /db_xref="GOA:A4X281"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X281"
FT                   /protein_id="ABP52981.1"
FT                   /translation="MNRRKHEEAGQRTPVDNAEHCCVGPERFSIRPMPGQVQSIARAAA
FT                   ILRLLASSSGRLGIGDIARSLNLPKGTAHGIIRTLQYVGFVEQDKTSGKYQLGAALLHL
FT                   GTSSLDVNELRSRSINWADPLAARSGEAVRVGTLLDGKVLVVHHVFRPDDTLQTLDVGS
FT                   LLPPHATALGKVLLAYDVGAANAVKQREPEPYTRRTLVTARALTRALSEVRDNGWGAEV
FT                   GEMTPGEAGIAAPIRGYGGLVVGAIGLSGPVDRTCDGSGNPRPALVTYVRDAARAVSRD
FT                   LGATRW"
     MNRRKHEEAG QRTPVDNAEH CCVGPERFSI RPMPGQVQSI ARAAAILRLL ASSSGRLGIG        60
     DIARSLNLPK GTAHGIIRTL QYVGFVEQDK TSGKYQLGAA LLHLGTSSLD VNELRSRSIN       120
     WADPLAARSG EAVRVGTLLD GKVLVVHHVF RPDDTLQTLD VGSLLPPHAT ALGKVLLAYD       180
     VGAANAVKQR EPEPYTRRTL VTARALTRAL SEVRDNGWGA EVGEMTPGEA GIAAPIRGYG       240
     GLVVGAIGLS GPVDRTCDGS GNPRPALVTY VRDAARAVSR DLGATRW                     287
//

If you have problems or comments...

PBIL Back to PBIL home page