(data stored in ACNUC7421 zone)

EMBL: CP000667.PE497

CP000667.PE497       Location/Qualifiers
FT   CDS             575604..577127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0497"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase,
FT                   FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52982"
FT                   /db_xref="GOA:A4X282"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A4X282"
FT                   /protein_id="ABP52982.1"
FT                   /translation="MTERFVVAIDQGTTSTRCIVFDRRGNLVSVAQREHRQHFPRPGWV
FT                   EHDAMEIWRNVGKVVPRALTQAGITIDQIAAIGIANQRETTIVWDRRTGVPVAPALIWQ
FT                   DTRTDLVVDALTRASGAADIQELCGLPLTTYFSGPKLRWLLDHVPGLAERADRGEVLFG
FT                   TMESWLIWNLTGGPDGGLHLTDVTNASRTMLMDLRTLDWHPRLLSFFGVPAAMLPQIRS
FT                   SSEVYGTATAVLPGVRIAAALGDQQAALFGQTCFDPGDAKCTYGTGSFLLLNTGTEPVP
FT                   SRHGLLTTVGYRIGGEPALYALEGSIAITGSLVQWFRDRLELISTAPEIETLARTVGDN
FT                   GGCYIVPAFSGLFAPHWRSEARGMIVGLTSYITKGHLARAVLEATGWQTREVVDAMNAD
FT                   SGLDLTTLRVDGGMTANNLLMQFVADVLAVPVVRPMAAETVSLGAAYAAGLAVQYWPDL
FT                   EGLRSNWHPAARWVPEMDAAVRTRERENWRRAVERTFDWIRPTEDPARR"
     MTERFVVAID QGTTSTRCIV FDRRGNLVSV AQREHRQHFP RPGWVEHDAM EIWRNVGKVV        60
     PRALTQAGIT IDQIAAIGIA NQRETTIVWD RRTGVPVAPA LIWQDTRTDL VVDALTRASG       120
     AADIQELCGL PLTTYFSGPK LRWLLDHVPG LAERADRGEV LFGTMESWLI WNLTGGPDGG       180
     LHLTDVTNAS RTMLMDLRTL DWHPRLLSFF GVPAAMLPQI RSSSEVYGTA TAVLPGVRIA       240
     AALGDQQAAL FGQTCFDPGD AKCTYGTGSF LLLNTGTEPV PSRHGLLTTV GYRIGGEPAL       300
     YALEGSIAIT GSLVQWFRDR LELISTAPEI ETLARTVGDN GGCYIVPAFS GLFAPHWRSE       360
     ARGMIVGLTS YITKGHLARA VLEATGWQTR EVVDAMNADS GLDLTTLRVD GGMTANNLLM       420
     QFVADVLAVP VVRPMAAETV SLGAAYAAGL AVQYWPDLEG LRSNWHPAAR WVPEMDAAVR       480
     TRERENWRRA VERTFDWIRP TEDPARR                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page