(data stored in ACNUC7421 zone)

EMBL: CP000667.PE498

CP000667.PE498       Location/Qualifiers
FT   CDS             577550..577855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52983"
FT                   /db_xref="GOA:A4X283"
FT                   /db_xref="UniProtKB/TrEMBL:A4X283"
FT                   /protein_id="ABP52983.1"
FT                   /translation="MSDEDVEAIRRRPAYRAAMWLGRLVIMPQVVPFVVVAIDDDVTVA
FT                   DAVFSYSWLSLVVLAGGFLLLWRAGVPFTRRGWSVETAADFTLNEAMTSDFFFRRR"
     MSDEDVEAIR RRPAYRAAMW LGRLVIMPQV VPFVVVAIDD DVTVADAVFS YSWLSLVVLA        60
     GGFLLLWRAG VPFTRRGWSV ETAADFTLNE AMTSDFFFRR R                           101
//

If you have problems or comments...

PBIL Back to PBIL home page