(data stored in ACNUC7421 zone)

EMBL: CP000667.PE499

CP000667.PE499       Location/Qualifiers
FT   CDS             577988..578272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52984"
FT                   /db_xref="UniProtKB/TrEMBL:A4X284"
FT                   /protein_id="ABP52984.1"
FT                   /translation="MPWCSLPRSLPLMTVWNTGYRHTSGTVVRMSGGVRLTAPGLRAGK
FT                   ACCVTGFSCALDSVLGGKGGPYAQAPNQPDMAELQVLPLHVHMRMVCGW"
     MPWCSLPRSL PLMTVWNTGY RHTSGTVVRM SGGVRLTAPG LRAGKACCVT GFSCALDSVL        60
     GGKGGPYAQA PNQPDMAELQ VLPLHVHMRM VCGW                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page