(data stored in ACNUC7421 zone)

EMBL: CP000667.PE50

CP000667.PE50        Location/Qualifiers
FT   CDS             complement(58865..59155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52535"
FT                   /db_xref="GOA:A4X0Y5"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y5"
FT                   /protein_id="ABP52535.1"
FT                   /translation="MYAWIWRKLPFGLPGKLAGSVLLATATVALLWYVVFPWAEPLLPF
FT                   DDVQVTQETGDPGDPGVPGYPPPGDGPAPTEDGHDLPYDTDENNTPPSSEE"
     MYAWIWRKLP FGLPGKLAGS VLLATATVAL LWYVVFPWAE PLLPFDDVQV TQETGDPGDP        60
     GVPGYPPPGD GPAPTEDGHD LPYDTDENNT PPSSEE                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page