(data stored in ACNUC7421 zone)

EMBL: CP000667.PE501

CP000667.PE501       Location/Qualifiers
FT   CDS             complement(579983..580789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52986"
FT                   /db_xref="UniProtKB/TrEMBL:A4X286"
FT                   /protein_id="ABP52986.1"
FT                   /translation="MTDWRSLWDAVVASDVGARDGLGWEFTSRTGEPAWAVFRGDDGPF
FT                   PVFSAARGQVMPSADDLAAMTHEAVADLLAAAGLADQHGWITENISAALLLASMSVESW
FT                   EGEEWALESGPHDVATAWAEPDAALTPYAWLRAIGTNTSAEISIYQNDMLFGLCFIPTT
FT                   ELRLPEFDLGSLRSRQGIPLVRGPINQVDVVYDTIVEGGRCAGLVSEVLLHGDHASTLL
FT                   IAAEAYSRHEWHLFDESVVALTEPTTADSLAWIPERHRWRRTEGVR"
     MTDWRSLWDA VVASDVGARD GLGWEFTSRT GEPAWAVFRG DDGPFPVFSA ARGQVMPSAD        60
     DLAAMTHEAV ADLLAAAGLA DQHGWITENI SAALLLASMS VESWEGEEWA LESGPHDVAT       120
     AWAEPDAALT PYAWLRAIGT NTSAEISIYQ NDMLFGLCFI PTTELRLPEF DLGSLRSRQG       180
     IPLVRGPINQ VDVVYDTIVE GGRCAGLVSE VLLHGDHAST LLIAAEAYSR HEWHLFDESV       240
     VALTEPTTAD SLAWIPERHR WRRTEGVR                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page