(data stored in ACNUC7421 zone)

EMBL: CP000667.PE51

CP000667.PE51        Location/Qualifiers
FT   CDS             complement(59160..60725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0051"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase
FT                   C60, sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52536"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y6"
FT                   /protein_id="ABP52536.1"
FT                   /translation="MTRASESWQPDRDDDQTAFLPRLERPWQQPRHESEQPSSPPGPAP
FT                   QPPSQPGALPQSGAPSQPGALPQPGAPSQPPGSTGTPQRPPTQSPWHAAAPASTPPAGS
FT                   AFDAAYPPTPPAADRPLDPPTAAHRNLRPASPPHSSEPAAPSPSPSPVNPRRPAWEGTS
FT                   STADAPTALIPTTPLRTAAPNASPAPNASPARSAGAAPGAGAAPDATPGTSPTADPAAT
FT                   ALIPRVASHTPPALDSTALMGAVPQPPRDADSTADSATPEPAQPRRGERVVKLRPEQSA
FT                   LGYKSVYSELTRPTFRSRLRTGVRAAGEVLITFGIVVLLFAGYEIWGKSVIVNAHQNDL
FT                   SQQLAEAWGPTGDPTVTPSAASSSASAPPTVQGIPIAGLYIPRLDKNWIVVEGVTQKDL
FT                   RYAPGHYPTSALPGQLGNFSIAGHRNRATFWRLDELDDGDVIVAEDRDEWHVYRVTRNH
FT                   VVKPSEVAVVAPVPGEPGAEPTDAMLTLTTCHPKFDNYERLIIHAKLDRTQAKSAGRPA
FT                   ELGG"
     MTRASESWQP DRDDDQTAFL PRLERPWQQP RHESEQPSSP PGPAPQPPSQ PGALPQSGAP        60
     SQPGALPQPG APSQPPGSTG TPQRPPTQSP WHAAAPASTP PAGSAFDAAY PPTPPAADRP       120
     LDPPTAAHRN LRPASPPHSS EPAAPSPSPS PVNPRRPAWE GTSSTADAPT ALIPTTPLRT       180
     AAPNASPAPN ASPARSAGAA PGAGAAPDAT PGTSPTADPA ATALIPRVAS HTPPALDSTA       240
     LMGAVPQPPR DADSTADSAT PEPAQPRRGE RVVKLRPEQS ALGYKSVYSE LTRPTFRSRL       300
     RTGVRAAGEV LITFGIVVLL FAGYEIWGKS VIVNAHQNDL SQQLAEAWGP TGDPTVTPSA       360
     ASSSASAPPT VQGIPIAGLY IPRLDKNWIV VEGVTQKDLR YAPGHYPTSA LPGQLGNFSI       420
     AGHRNRATFW RLDELDDGDV IVAEDRDEWH VYRVTRNHVV KPSEVAVVAP VPGEPGAEPT       480
     DAMLTLTTCH PKFDNYERLI IHAKLDRTQA KSAGRPAELG G                           521
//

If you have problems or comments...

PBIL Back to PBIL home page