(data stored in ACNUC7421 zone)

EMBL: CP000667.PE510

CP000667.PE510       Location/Qualifiers
FT   CDS             complement(588475..588921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52995"
FT                   /db_xref="UniProtKB/TrEMBL:A4X295"
FT                   /protein_id="ABP52995.1"
FT                   /translation="MIRAHDPMRPLWRCRACGADWPCQPARLALLDEYRGRRSALLARQ
FT                   GKLLAQASDQLSRLNGTKPDLRERFVDWCWRAEHEDPTIGVFESVDLDFLFRAIEAVIR
FT                   YHWGGWTCPECTDSGCPRLDWVDASLDVLQRRSQGRPEAEGPKR"
     MIRAHDPMRP LWRCRACGAD WPCQPARLAL LDEYRGRRSA LLARQGKLLA QASDQLSRLN        60
     GTKPDLRERF VDWCWRAEHE DPTIGVFESV DLDFLFRAIE AVIRYHWGGW TCPECTDSGC       120
     PRLDWVDASL DVLQRRSQGR PEAEGPKR                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page