(data stored in ACNUC7421 zone)

EMBL: CP000667.PE511

CP000667.PE511       Location/Qualifiers
FT   CDS             589581..590393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0512"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52996"
FT                   /db_xref="GOA:A4X296"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4X296"
FT                   /protein_id="ABP52996.1"
FT                   /translation="MMLRALREAAELSTAQVAEHLASSQPKVSRIENAVSPVSKGDLML
FT                   MLNLYGVTDPDEQDRHWQLARAGRERGWWESYRDVLTGSLGSYIGFENEAESLKIWSWG
FT                   VFPGLLQTEAYARALFASDPVRTEPEEVDRLVAARMQRQQRIAEDGLNLWVVLDESLLH
FT                   RQVGPPGVLAKQLERIAEPPPGVTVQVLPSNVGCHPGLSGAFTIMEFAEFPTIAYRETL
FT                   TGDTPVEAVPDVGRYTLAFDHLRASALSPVESRKAAVSVTRELRKEQQ"
     MMLRALREAA ELSTAQVAEH LASSQPKVSR IENAVSPVSK GDLMLMLNLY GVTDPDEQDR        60
     HWQLARAGRE RGWWESYRDV LTGSLGSYIG FENEAESLKI WSWGVFPGLL QTEAYARALF       120
     ASDPVRTEPE EVDRLVAARM QRQQRIAEDG LNLWVVLDES LLHRQVGPPG VLAKQLERIA       180
     EPPPGVTVQV LPSNVGCHPG LSGAFTIMEF AEFPTIAYRE TLTGDTPVEA VPDVGRYTLA       240
     FDHLRASALS PVESRKAAVS VTRELRKEQQ                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page