(data stored in ACNUC7421 zone)

EMBL: CP000667.PE513

CP000667.PE513       Location/Qualifiers
FT   CDS             complement(590639..591148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52998"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:A4X298"
FT                   /protein_id="ABP52998.1"
FT                   /translation="MTYTRVFVEQTLPLMLDGRPGSHGRGPRPSRACRQCDPHRGRERC
FT                   THRCDLSPACISTFEGSEFGICQHVHSGRRTGGCGVCWCLGAHDRRATAASGASTIDAV
FT                   LADIGVAWERSPWLLHMHRRRMYMRYALDWPVGRIAQEEGVSASSVSRTLTAGVDAIVG
FT                   YLEDDT"
     MTYTRVFVEQ TLPLMLDGRP GSHGRGPRPS RACRQCDPHR GRERCTHRCD LSPACISTFE        60
     GSEFGICQHV HSGRRTGGCG VCWCLGAHDR RATAASGAST IDAVLADIGV AWERSPWLLH       120
     MHRRRMYMRY ALDWPVGRIA QEEGVSASSV SRTLTAGVDA IVGYLEDDT                   169
//

If you have problems or comments...

PBIL Back to PBIL home page