(data stored in ACNUC7421 zone)

EMBL: CP000667.PE514

CP000667.PE514       Location/Qualifiers
FT   CDS             complement(591145..591618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52999"
FT                   /db_xref="UniProtKB/TrEMBL:A4X299"
FT                   /protein_id="ABP52999.1"
FT                   /translation="MNITPRREEIAEVVAILESGAYDGPDAMAADLIRAVAGLLWFRTW
FT                   WVLGARGPRAANFGPFASEAEAVRWGKQVANMAIPAEWGVVQVHGMGRIATNAKGGREG
FT                   GGFGYCVTAGCGCPPYAHAMDKSTRGKCVICGSCDRYQQSERKPAKRAKREPA"
     MNITPRREEI AEVVAILESG AYDGPDAMAA DLIRAVAGLL WFRTWWVLGA RGPRAANFGP        60
     FASEAEAVRW GKQVANMAIP AEWGVVQVHG MGRIATNAKG GREGGGFGYC VTAGCGCPPY       120
     AHAMDKSTRG KCVICGSCDR YQQSERKPAK RAKREPA                                157
//

If you have problems or comments...

PBIL Back to PBIL home page