(data stored in ACNUC7421 zone)

EMBL: CP000667.PE516

CP000667.PE516       Location/Qualifiers
FT   CDS             complement(592120..592905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53001"
FT                   /db_xref="GOA:A4X2A1"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2A1"
FT                   /protein_id="ABP53001.1"
FT                   /translation="MDDDLSSDDRATARTLYIDIETAPSLAHVWGLWRQNIGLSQLLAS
FT                   GRVICLAWKWRGEEGVHFASEHGQGRDAMLASAHRILGEADVVVHYNGKRFDIPTLNRD
FT                   FILAGKLPPAPFRQLDLLETVKRRFRFTSNKLAHISQELGLEGKVKHEGHTLWVRCLAG
FT                   DPEAWEQMAEYNRRDVTLLEQLHDVLMPWLVRAPNPRLTDGVSDVDTCPNCGSTDLARE
FT                   GHAYTATGAYQRHRCRACGAWSRRGRRSHGIDIRPIANN"
     MDDDLSSDDR ATARTLYIDI ETAPSLAHVW GLWRQNIGLS QLLASGRVIC LAWKWRGEEG        60
     VHFASEHGQG RDAMLASAHR ILGEADVVVH YNGKRFDIPT LNRDFILAGK LPPAPFRQLD       120
     LLETVKRRFR FTSNKLAHIS QELGLEGKVK HEGHTLWVRC LAGDPEAWEQ MAEYNRRDVT       180
     LLEQLHDVLM PWLVRAPNPR LTDGVSDVDT CPNCGSTDLA REGHAYTATG AYQRHRCRAC       240
     GAWSRRGRRS HGIDIRPIAN N                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page