(data stored in ACNUC7421 zone)

EMBL: CP000667.PE52

CP000667.PE52        Location/Qualifiers
FT   CDS             complement(60722..61651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0052"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52537"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y7"
FT                   /protein_id="ABP52537.1"
FT                   /translation="MANNVSTASVVRKTRSGHERVFSNTPEGSSERAGTRREEGNPVEY
FT                   TSGAASWRKVLRRVVAALIQRPRQRRLGWPVGVPLIAAAAGLLFTTTATTAGGTTLRED
FT                   RRPQLNQLIQDRHTEVAASEQRAAELRATVEARTNALAGSDGTIQQQQERAAASQEPAG
FT                   FTALTGLGVTVELDDAPRRNDGSLPTGVTNHDLVVHQGDVQAVVNALWAGGAEAMSIMD
FT                   VRVLATSAVRCVGNTLLLHGRVYSPPFKIVAIGDPAALQRALAESEGVRLFRDLANTYK
FT                   LGYKETVSTVSVPAFDGSAALRWATVPE"
     MANNVSTASV VRKTRSGHER VFSNTPEGSS ERAGTRREEG NPVEYTSGAA SWRKVLRRVV        60
     AALIQRPRQR RLGWPVGVPL IAAAAGLLFT TTATTAGGTT LREDRRPQLN QLIQDRHTEV       120
     AASEQRAAEL RATVEARTNA LAGSDGTIQQ QQERAAASQE PAGFTALTGL GVTVELDDAP       180
     RRNDGSLPTG VTNHDLVVHQ GDVQAVVNAL WAGGAEAMSI MDVRVLATSA VRCVGNTLLL       240
     HGRVYSPPFK IVAIGDPAAL QRALAESEGV RLFRDLANTY KLGYKETVST VSVPAFDGSA       300
     ALRWATVPE                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page