(data stored in ACNUC7421 zone)

EMBL: CP000667.PE524

CP000667.PE524       Location/Qualifiers
FT   CDS             complement(598639..598983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53009"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2A9"
FT                   /protein_id="ABP53009.1"
FT                   /translation="MRVIIFVPDSRGSARTRRVIQREVVAQGHVVVGATSAPAEAMAAW
FT                   RSQVADSIAGRPDHLIQLADDWALPITSRSRPDACADTEKSTAHGRSRAKPSRARRYRR
FT                   LPGGSALRTR"
     MRVIIFVPDS RGSARTRRVI QREVVAQGHV VVGATSAPAE AMAAWRSQVA DSIAGRPDHL        60
     IQLADDWALP ITSRSRPDAC ADTEKSTAHG RSRAKPSRAR RYRRLPGGSA LRTR             114
//

If you have problems or comments...

PBIL Back to PBIL home page