(data stored in ACNUC7421 zone)

EMBL: CP000667.PE527

CP000667.PE527       Location/Qualifiers
FT   CDS             complement(600227..601231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0528"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53012"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2B2"
FT                   /protein_id="ABP53012.1"
FT                   /translation="MSPTSDALKWLWEEFRKVEGAARFGGIYANKRGYHNTRDANVARW
FT                   PGNYSYAQFSVDREGPPGLASAIDLTFADAQAGRYETIDKYSSRLLAAGHAGRAADPRT
FT                   IYMREFYGQADHDVHVEGWDYARGQAVTSDSSHLWHIHISVHRKYADDMTAMRAILSIL
FT                   KGETVEQWRKGQGGTPSPPPLPDQAAGSRMLRLTVPYARGTDVAAVQDAVGATRDGVFG
FT                   PKTRSAVIKYQRARGLTPDGIVGPKTWATLLGSLPSHPNGSRVLRLRRPTHMRGTDVEA
FT                   VQRFIGARCGAADGIFGTKTASGVRWYQRMRGLTPDGIVGPKTWAPIVRTIGR"
     MSPTSDALKW LWEEFRKVEG AARFGGIYAN KRGYHNTRDA NVARWPGNYS YAQFSVDREG        60
     PPGLASAIDL TFADAQAGRY ETIDKYSSRL LAAGHAGRAA DPRTIYMREF YGQADHDVHV       120
     EGWDYARGQA VTSDSSHLWH IHISVHRKYA DDMTAMRAIL SILKGETVEQ WRKGQGGTPS       180
     PPPLPDQAAG SRMLRLTVPY ARGTDVAAVQ DAVGATRDGV FGPKTRSAVI KYQRARGLTP       240
     DGIVGPKTWA TLLGSLPSHP NGSRVLRLRR PTHMRGTDVE AVQRFIGARC GAADGIFGTK       300
     TASGVRWYQR MRGLTPDGIV GPKTWAPIVR TIGR                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page