(data stored in ACNUC7421 zone)

EMBL: CP000667.PE531

CP000667.PE531       Location/Qualifiers
FT   CDS             complement(605100..605963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53016"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2B6"
FT                   /protein_id="ABP53016.1"
FT                   /translation="MHLRFRSDTDVMRLDGISRTGYGVEALRGVTGFGLPPVSTQWRAG
FT                   AGDGAAYRGERKQPRDIDIPLHIFAPDREALEREKTRLSLVLMQGEFDLDVVEDGGAYW
FT                   TTRVVRVGGGDIAYGDGTTGDRELTTIVTLRAGYPYFTSHEERCKEVTNAGAGRGLLGA
FT                   GFSLVALKISGSQAIGDMLLVNDGDAVTWPVWRIVGPGQDLVVSDGSRAMKWLGALSAG
FT                   EELIINTRASTVRTLAGTNRYSELAPAPRFWPLPPGQTLARVSMVNTTGESAIRATWRP
FT                   RKWWVI"
     MHLRFRSDTD VMRLDGISRT GYGVEALRGV TGFGLPPVST QWRAGAGDGA AYRGERKQPR        60
     DIDIPLHIFA PDREALEREK TRLSLVLMQG EFDLDVVEDG GAYWTTRVVR VGGGDIAYGD       120
     GTTGDRELTT IVTLRAGYPY FTSHEERCKE VTNAGAGRGL LGAGFSLVAL KISGSQAIGD       180
     MLLVNDGDAV TWPVWRIVGP GQDLVVSDGS RAMKWLGALS AGEELIINTR ASTVRTLAGT       240
     NRYSELAPAP RFWPLPPGQT LARVSMVNTT GESAIRATWR PRKWWVI                     287
//

If you have problems or comments...

PBIL Back to PBIL home page