(data stored in ACNUC7421 zone)

EMBL: CP000667.PE532

CP000667.PE532       Location/Qualifiers
FT   CDS             complement(605966..609199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0533"
FT                   /product="Phage-related protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53017"
FT                   /db_xref="GOA:A4X2B7"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2B7"
FT                   /protein_id="ABP53017.1"
FT                   /translation="MTDQIIGRIFVKVTPDTSAFRAEAKAQLEREERRLPELTTRLAVE
FT                   LDDGEAAETAAEARAVRDSAQQAMRDLTLRVNLDDLSSVRSALARVNAELVNLDAIELP
FT                   VELDRDSLESMRDLLEQRVKDIGIDIKVNLDDEASIERAIKKVEAQLSALNEINLNVDL
FT                   NDASLSAAKAELEARLDQVRVETDIDNAASARVSAALAILTRTRDAVIRPVIDRSALAA
FT                   VRFVDVLSGFRALRESIAQARTAFLGLFTNLPQISTMALAVTALSGALVSAAGNAIGLA
FT                   GSLAQLLPIALALPGIAIGLAAMAVAFADFGNQLPAVAERFGQLQGIISDGFWEIARGP
FT                   INNLLTAALPLLEAGLGKVSGSIGGFFAAFAGSLGAEGGFLSELPQMFDRLNESINIFT
FT                   GYTPALAAIMTIFGQIGSSILPPLADLIGRTADEFAAFLTAQTAGDGLTSIVESSIEAL
FT                   SGLIETLKGAFQVFTALWRAADAAGTATLSSLGSGLQEFAKTLEGPEIQGALTSLFSAV
FT                   QEMFDSFVNEAGPAFSQVFIGLVSVLRDVLPLVGSAWGQMAAVLGEIFSTPAFQEGLTS
FT                   FFVGVNAAVTALLPALTPIADLVGSLGPVLGQLAAQIGEVFGSLTPTLDGLVAALLPVI
FT                   EMLGDGLVQVVRAISPALSEIATVASATLSGLTPLLQPIIDALVQIVQAVLPALMPVIS
FT                   ALQPLLLSIAELALPVISTLLAALAPILADAVAALQPVIDIIVELLDLLVPLLIPALDM
FT                   MTRALAQNLGVVVEGAAQAIAGLVDVIRGVIDFLVGVFTGDWERAWSGVQSIFSGIIDA
FT                   VIGILKIIFGPFGTMAGIFSDGLSRVSDLWSSVWSSVGAVAVAAWNGIVNHIQDRINFM
FT                   VGIFRGIWGAVSGAITSLWNEIRRQFERGIQTAVDAVDTGVDDTLSFFRNLPDQIRSAL
FT                   GNLGKLLVDAGKALLRGLIDGIQSMFGEVRGNLNSLTDLMPDWKGPPSTDRTLLYGAGR
FT                   LIIDGFIEGLESRYDMVRRSLGELTKDVASTEFGVPTASLGINSDAYGSDVGRATDSKT
FT                   INYHAAPGSSMDSEEDLFAALGRARAWGW"
     MTDQIIGRIF VKVTPDTSAF RAEAKAQLER EERRLPELTT RLAVELDDGE AAETAAEARA        60
     VRDSAQQAMR DLTLRVNLDD LSSVRSALAR VNAELVNLDA IELPVELDRD SLESMRDLLE       120
     QRVKDIGIDI KVNLDDEASI ERAIKKVEAQ LSALNEINLN VDLNDASLSA AKAELEARLD       180
     QVRVETDIDN AASARVSAAL AILTRTRDAV IRPVIDRSAL AAVRFVDVLS GFRALRESIA       240
     QARTAFLGLF TNLPQISTMA LAVTALSGAL VSAAGNAIGL AGSLAQLLPI ALALPGIAIG       300
     LAAMAVAFAD FGNQLPAVAE RFGQLQGIIS DGFWEIARGP INNLLTAALP LLEAGLGKVS       360
     GSIGGFFAAF AGSLGAEGGF LSELPQMFDR LNESINIFTG YTPALAAIMT IFGQIGSSIL       420
     PPLADLIGRT ADEFAAFLTA QTAGDGLTSI VESSIEALSG LIETLKGAFQ VFTALWRAAD       480
     AAGTATLSSL GSGLQEFAKT LEGPEIQGAL TSLFSAVQEM FDSFVNEAGP AFSQVFIGLV       540
     SVLRDVLPLV GSAWGQMAAV LGEIFSTPAF QEGLTSFFVG VNAAVTALLP ALTPIADLVG       600
     SLGPVLGQLA AQIGEVFGSL TPTLDGLVAA LLPVIEMLGD GLVQVVRAIS PALSEIATVA       660
     SATLSGLTPL LQPIIDALVQ IVQAVLPALM PVISALQPLL LSIAELALPV ISTLLAALAP       720
     ILADAVAALQ PVIDIIVELL DLLVPLLIPA LDMMTRALAQ NLGVVVEGAA QAIAGLVDVI       780
     RGVIDFLVGV FTGDWERAWS GVQSIFSGII DAVIGILKII FGPFGTMAGI FSDGLSRVSD       840
     LWSSVWSSVG AVAVAAWNGI VNHIQDRINF MVGIFRGIWG AVSGAITSLW NEIRRQFERG       900
     IQTAVDAVDT GVDDTLSFFR NLPDQIRSAL GNLGKLLVDA GKALLRGLID GIQSMFGEVR       960
     GNLNSLTDLM PDWKGPPSTD RTLLYGAGRL IIDGFIEGLE SRYDMVRRSL GELTKDVAST      1020
     EFGVPTASLG INSDAYGSDV GRATDSKTIN YHAAPGSSMD SEEDLFAALG RARAWGW         1077
//

If you have problems or comments...

PBIL Back to PBIL home page