(data stored in ACNUC7421 zone)

EMBL: CP000667.PE535

CP000667.PE535       Location/Qualifiers
FT   CDS             complement(610719..611204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53020"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2C0"
FT                   /protein_id="ABP53020.1"
FT                   /translation="MAGLPPSVIAAQEFSPIEDLLLAALAYYLPDVKAGTLIMMAQTFP
FT                   FIHLRRLDSYGVWAGDERFIDDAHMAIYAYAEDPDGDEDAGRLAEAVRASLMRARRARF
FT                   GVPELGHFVGLTMTASPRRVPDWATATGPVQYADLPAGVWRYETRFDVTVRRPRQQP"
     MAGLPPSVIA AQEFSPIEDL LLAALAYYLP DVKAGTLIMM AQTFPFIHLR RLDSYGVWAG        60
     DERFIDDAHM AIYAYAEDPD GDEDAGRLAE AVRASLMRAR RARFGVPELG HFVGLTMTAS       120
     PRRVPDWATA TGPVQYADLP AGVWRYETRF DVTVRRPRQQ P                           161
//

If you have problems or comments...

PBIL Back to PBIL home page