(data stored in ACNUC7421 zone)

EMBL: CP000667.PE537

CP000667.PE537       Location/Qualifiers
FT   CDS             complement(611661..612029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53022"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2C2"
FT                   /protein_id="ABP53022.1"
FT                   /translation="MLRPMPSMQRRRGQSATVYPYREVTDRRGHRVRVVDEDNPVVVVA
FT                   AFIPDRSSRAELPGQQQIHVVKMIVRDDVAGCELWAQVEWRGSRWDVVTPPAYHHGTRH
FT                   TRHVTVSLRRRPLTPTEV"
     MLRPMPSMQR RRGQSATVYP YREVTDRRGH RVRVVDEDNP VVVVAAFIPD RSSRAELPGQ        60
     QQIHVVKMIV RDDVAGCELW AQVEWRGSRW DVVTPPAYHH GTRHTRHVTV SLRRRPLTPT       120
     EV                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page