(data stored in ACNUC7421 zone)

EMBL: CP000667.PE54

CP000667.PE54        Location/Qualifiers
FT   CDS             62287..64485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0054"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52539"
FT                   /db_xref="GOA:A4X0Y9"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y9"
FT                   /protein_id="ABP52539.1"
FT                   /translation="MGSVQIVTTIVAAAITAVAVWLAVRAVMKMVAVIRLGQPDPARFT
FT                   DWATRTKTMLAETAGHTRMLRWSLVGAAHWFVMVGFIVLSLLVLEAYFEVVSPTGGLPL
FT                   IGSWAVYGLVTEALGVFGIASILVLIAIRVRNRPTRPGGRSRFTGSTMWQGYFVEAVIL
FT                   GVLVMGFLIRGFKVATDHFEYPVWATPLSHAVGGLLPDWEAGVSIAAVIKIAISMAWLI
FT                   VISLNVTMGVAWHRFLAFPNIFFKRNPGRPGSGLGALRPMTSNGELLDFEEADPEKDQF
FT                   GVAQVEQFTWKGLLDFSTCTECGRCQSQCPAWNTGKPLSPKLLVLSLRDHAYAKAPYLL
FT                   AGGGKDLTGAEKAADGQLAHVDALALAEAEKPLIGGVEESGVIDPDVLWSCTTCGACVE
FT                   QCPVDIEHVDHIVDMRRYQMLIESSFPSEAGVMLRNLENKGNPWGAPQNTREDWTKGLD
FT                   FEVPRVGEVDDFEYLFWVGCAGAFEDRAKKTTRAVATLLHEAGVSFAILGEGETCSGDP
FT                   ARRIGNEFVFQMLAQQNVETLNEAFDGREKSQRKIVATCPHCFNTLGNEYGQLGGEFEV
FT                   VHHTQLLAHLVATGALTPVQPIDGGVTYHDPCYLGRHNRVFAPPREVLGTAVQGEVTEM
FT                   PRNSERSFCCGAGGARMWMEEKIGKRINVDRVEEAMSTGAATVAVGCPFCSTMLNDGVN
FT                   GKGAGEQVEVVDVASVLLRSVRPEQPQADQKSDERVAG"
     MGSVQIVTTI VAAAITAVAV WLAVRAVMKM VAVIRLGQPD PARFTDWATR TKTMLAETAG        60
     HTRMLRWSLV GAAHWFVMVG FIVLSLLVLE AYFEVVSPTG GLPLIGSWAV YGLVTEALGV       120
     FGIASILVLI AIRVRNRPTR PGGRSRFTGS TMWQGYFVEA VILGVLVMGF LIRGFKVATD       180
     HFEYPVWATP LSHAVGGLLP DWEAGVSIAA VIKIAISMAW LIVISLNVTM GVAWHRFLAF       240
     PNIFFKRNPG RPGSGLGALR PMTSNGELLD FEEADPEKDQ FGVAQVEQFT WKGLLDFSTC       300
     TECGRCQSQC PAWNTGKPLS PKLLVLSLRD HAYAKAPYLL AGGGKDLTGA EKAADGQLAH       360
     VDALALAEAE KPLIGGVEES GVIDPDVLWS CTTCGACVEQ CPVDIEHVDH IVDMRRYQML       420
     IESSFPSEAG VMLRNLENKG NPWGAPQNTR EDWTKGLDFE VPRVGEVDDF EYLFWVGCAG       480
     AFEDRAKKTT RAVATLLHEA GVSFAILGEG ETCSGDPARR IGNEFVFQML AQQNVETLNE       540
     AFDGREKSQR KIVATCPHCF NTLGNEYGQL GGEFEVVHHT QLLAHLVATG ALTPVQPIDG       600
     GVTYHDPCYL GRHNRVFAPP REVLGTAVQG EVTEMPRNSE RSFCCGAGGA RMWMEEKIGK       660
     RINVDRVEEA MSTGAATVAV GCPFCSTMLN DGVNGKGAGE QVEVVDVASV LLRSVRPEQP       720
     QADQKSDERV AG                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page