(data stored in ACNUC7421 zone)

EMBL: CP000667.PE543

CP000667.PE543       Location/Qualifiers
FT   CDS             complement(616082..617215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53028"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2C8"
FT                   /protein_id="ABP53028.1"
FT                   /translation="MTTVHITLSETNPTAEYVALQRYSGAMLFGTRLRVYLDGAAEATV
FT                   DLESTVGRAWRWRAQEIGYHDMVTRTVAVPESETPVEYADLVDVDPETMQPDDEPEAAW
FT                   WQALSETAAGVVPDGSVGLVKLAPDVLAALDEVGQPGPQGDQGLSAYEVAVAGGYSGTE
FT                   ADWLLGLVGPAGLPGATGDPGPGVTAGGTVGQVLAKGSATDHDTEWIDPVPSAHASSHA
FT                   PGGADDLSATYSAVDTVHDSAPPRDYLRRIRLDYPISVGNPDIERIYVGTGAGELSAWR
FT                   NEWGGLRGTPHVAYKADALVRGIPRTDLGASADGGWLELEDASRTTQLYKRDWWGRLWR
FT                   SDGAAAAIQMADVLVLGPGDPVPSGTPAGTVIVRTEA"
     MTTVHITLSE TNPTAEYVAL QRYSGAMLFG TRLRVYLDGA AEATVDLEST VGRAWRWRAQ        60
     EIGYHDMVTR TVAVPESETP VEYADLVDVD PETMQPDDEP EAAWWQALSE TAAGVVPDGS       120
     VGLVKLAPDV LAALDEVGQP GPQGDQGLSA YEVAVAGGYS GTEADWLLGL VGPAGLPGAT       180
     GDPGPGVTAG GTVGQVLAKG SATDHDTEWI DPVPSAHASS HAPGGADDLS ATYSAVDTVH       240
     DSAPPRDYLR RIRLDYPISV GNPDIERIYV GTGAGELSAW RNEWGGLRGT PHVAYKADAL       300
     VRGIPRTDLG ASADGGWLEL EDASRTTQLY KRDWWGRLWR SDGAAAAIQM ADVLVLGPGD       360
     PVPSGTPAGT VIVRTEA                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page