(data stored in ACNUC7421 zone)

EMBL: CP000667.PE547

CP000667.PE547       Location/Qualifiers
FT   CDS             complement(621048..621323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53032"
FT                   /db_xref="GOA:A4X2D2"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2D2"
FT                   /protein_id="ABP53032.1"
FT                   /translation="MPLRPVAGLAEYKSRWRWAWAIWLAVVAASFAVMEGLALVRRRPG
FT                   DTLSEATRHWIKAKKGRGLSRGEWGLIAALGAFLIWFLPHITLEIW"
     MPLRPVAGLA EYKSRWRWAW AIWLAVVAAS FAVMEGLALV RRRPGDTLSE ATRHWIKAKK        60
     GRGLSRGEWG LIAALGAFLI WFLPHITLEI W                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page