(data stored in ACNUC7421 zone)

EMBL: CP000667.PE55

CP000667.PE55        Location/Qualifiers
FT   CDS             64800..65813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0055"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52540"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Z0"
FT                   /protein_id="ABP52540.1"
FT                   /translation="MATTSPHRQASARSRRPGGLRRAAHGLLAAVAAVAVGLGVLAVPA
FT                   YAEPSVDEIEAAIDKQWREMEPTIAQYNKVRAQLKENRKKSDELAKKIAPLQLESEIAT
FT                   KRIGGLASEYYISGPSRELGALLVSDDPNEISEELALLNRVAAMERKQLEEVLAIRKEY
FT                   DDQKETLDELIAAQDKQESELAARKKQIDAEIKRLKASLPKTTVSTPQCPTVNGVVSAA
FT                   ARTAIRTACAQVGDPYVFGSSGPNSFDCSGLTQYAYKAAGVYLTHYTGAQWNEGKAISR
FT                   SEARPGDLVFFSSPSNLHHVGLYLGNDQMVHAPRTGKPVMVGSINYMPVAGFRRPG"
     MATTSPHRQA SARSRRPGGL RRAAHGLLAA VAAVAVGLGV LAVPAYAEPS VDEIEAAIDK        60
     QWREMEPTIA QYNKVRAQLK ENRKKSDELA KKIAPLQLES EIATKRIGGL ASEYYISGPS       120
     RELGALLVSD DPNEISEELA LLNRVAAMER KQLEEVLAIR KEYDDQKETL DELIAAQDKQ       180
     ESELAARKKQ IDAEIKRLKA SLPKTTVSTP QCPTVNGVVS AAARTAIRTA CAQVGDPYVF       240
     GSSGPNSFDC SGLTQYAYKA AGVYLTHYTG AQWNEGKAIS RSEARPGDLV FFSSPSNLHH       300
     VGLYLGNDQM VHAPRTGKPV MVGSINYMPV AGFRRPG                                337
//

If you have problems or comments...

PBIL Back to PBIL home page