(data stored in ACNUC7421 zone)

EMBL: CP000667.PE550

CP000667.PE550       Location/Qualifiers
FT   CDS             624738..625118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53035"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2D5"
FT                   /protein_id="ABP53035.1"
FT                   /translation="MIEIEQARELLAKAVETQGWDFVYNPGGNGPCKYEPISVHEAGGN
FT                   PDDPRTKTGCLIGVVLGMVDENRHRGLSNTIDALGEGALRGLMSHETTRYFRVAQHAQD
FT                   AGRTWGAAYDAAEAHYRAHYAR"
     MIEIEQAREL LAKAVETQGW DFVYNPGGNG PCKYEPISVH EAGGNPDDPR TKTGCLIGVV        60
     LGMVDENRHR GLSNTIDALG EGALRGLMSH ETTRYFRVAQ HAQDAGRTWG AAYDAAEAHY       120
     RAHYAR                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page