(data stored in ACNUC7421 zone)

EMBL: CP000667.PE553

CP000667.PE553       Location/Qualifiers
FT   CDS             627903..628235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53038"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2D8"
FT                   /protein_id="ABP53038.1"
FT                   /translation="MSESHGREFSDEQWAVLEQIVEGLSLSDAEKRLLAGHADPDAACV
FT                   LNAVGKMLMFGVDPVELCFVVGVSVARTNPAQVRGLVGRVVNGVARGLINDLVGGLDFP
FT                   DSEGNR"
     MSESHGREFS DEQWAVLEQI VEGLSLSDAE KRLLAGHADP DAACVLNAVG KMLMFGVDPV        60
     ELCFVVGVSV ARTNPAQVRG LVGRVVNGVA RGLINDLVGG LDFPDSEGNR                  110
//

If you have problems or comments...

PBIL Back to PBIL home page