(data stored in ACNUC7421 zone)

EMBL: CP000667.PE554

CP000667.PE554       Location/Qualifiers
FT   CDS             628504..629220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0557"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53039"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2D9"
FT                   /protein_id="ABP53039.1"
FT                   /translation="MVCEVKGCGRGVAARGWCALHWRRWRVHGDPLTVLPRSGGRRPKP
FT                   PKPCSIEGCEGPCHARGWCMTHYQRWLRTGDTRDSRAGRSLCGLPGCGRQHYGRGWCKR
FT                   HHRRWEVSGDPLGADRPANHACPETLALWHCTTPLVRADIRACMTAWSLGRWGDVTLYA
FT                   RRARGHGRSLSRLEREVVDGMLADCRKNWVESAPLVAELAESGLSVSEISAQLGVSERT
FT                   VYRKRAQHRSLKEGRT"
     MVCEVKGCGR GVAARGWCAL HWRRWRVHGD PLTVLPRSGG RRPKPPKPCS IEGCEGPCHA        60
     RGWCMTHYQR WLRTGDTRDS RAGRSLCGLP GCGRQHYGRG WCKRHHRRWE VSGDPLGADR       120
     PANHACPETL ALWHCTTPLV RADIRACMTA WSLGRWGDVT LYARRARGHG RSLSRLEREV       180
     VDGMLADCRK NWVESAPLVA ELAESGLSVS EISAQLGVSE RTVYRKRAQH RSLKEGRT         238
//

If you have problems or comments...

PBIL Back to PBIL home page