(data stored in ACNUC7421 zone)

EMBL: CP000667.PE555

CP000667.PE555       Location/Qualifiers
FT   CDS             629526..629711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53040"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E0"
FT                   /protein_id="ABP53040.1"
FT                   /translation="MENELLTVPEVLSTLKETSRRTFYRWRELGIAPECIKLPNGQLRV
FT                   ERRDLEAWIEQHREAA"
     MENELLTVPE VLSTLKETSR RTFYRWRELG IAPECIKLPN GQLRVERRDL EAWIEQHREA        60
     A                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page