(data stored in ACNUC7421 zone)

EMBL: CP000667.PE556

CP000667.PE556       Location/Qualifiers
FT   CDS             629708..631102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0559"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53041"
FT                   /db_xref="GOA:A4X2E1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E1"
FT                   /protein_id="ABP53041.1"
FT                   /translation="MKSRSVRIWEIRINKGAGKKKTYTVRWIVGGRVSSRNFASRALAD
FT                   NYRSDLMQAANRGEAFDAATGLPDSMTEPKNAMSWLEFVASYVDVKWPGAAAKSRESMI
FT                   DALATVTPALVRDQPGRPGPVELRRVLRDHLLPPAVRESEVPADLAPALRWLRRASLPL
FT                   AEVGETVAVRGALEALAVRLDGRAAAATTVRRKRSVFYNALQYAVELDALPFNPVDKIR
FT                   VRGQRAKIAKSIDRRVVINGRQARELLTAVSYVGERGRDGRRGERLVAFFGCLYFAALR
FT                   PSEALALREQDCDLPETGWGRLTLEKSRPAAGKRYTDSGEVHDRRGLKHRAVAEARTVP
FT                   IPPVLVKALRVHLDRFGAAKDGRLFRSERGNVVSSTTYSRVWKAARELALTPAQVASPM
FT                   AGRPYDLRHAAVSLWLNKGVPAPDVADRAGHSVDVLLKVYAKCIDGQEATVNQRIEEAL
FT                   DDDSHG"
     MKSRSVRIWE IRINKGAGKK KTYTVRWIVG GRVSSRNFAS RALADNYRSD LMQAANRGEA        60
     FDAATGLPDS MTEPKNAMSW LEFVASYVDV KWPGAAAKSR ESMIDALATV TPALVRDQPG       120
     RPGPVELRRV LRDHLLPPAV RESEVPADLA PALRWLRRAS LPLAEVGETV AVRGALEALA       180
     VRLDGRAAAA TTVRRKRSVF YNALQYAVEL DALPFNPVDK IRVRGQRAKI AKSIDRRVVI       240
     NGRQARELLT AVSYVGERGR DGRRGERLVA FFGCLYFAAL RPSEALALRE QDCDLPETGW       300
     GRLTLEKSRP AAGKRYTDSG EVHDRRGLKH RAVAEARTVP IPPVLVKALR VHLDRFGAAK       360
     DGRLFRSERG NVVSSTTYSR VWKAARELAL TPAQVASPMA GRPYDLRHAA VSLWLNKGVP       420
     APDVADRAGH SVDVLLKVYA KCIDGQEATV NQRIEEALDD DSHG                        464
//

If you have problems or comments...

PBIL Back to PBIL home page