(data stored in ACNUC7421 zone)

EMBL: CP000667.PE557

CP000667.PE557       Location/Qualifiers
FT   CDS             631876..632352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53042"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E2"
FT                   /protein_id="ABP53042.1"
FT                   /translation="MVPMKLAEALALRSDAARRAERLRARITASARYQEGETPAEDASA
FT                   LLAEAGEALGELESLIRRINRTNAVTVVREGGTLTDALARRDVLRLRHSVVTSAADAAA
FT                   GEGQRGYRQLRSELTMVPALSVSELRGQADDLARQLREVDTLIQRTNWEVDLLD"
     MVPMKLAEAL ALRSDAARRA ERLRARITAS ARYQEGETPA EDASALLAEA GEALGELESL        60
     IRRINRTNAV TVVREGGTLT DALARRDVLR LRHSVVTSAA DAAAGEGQRG YRQLRSELTM       120
     VPALSVSELR GQADDLARQL REVDTLIQRT NWEVDLLD                               158
//

If you have problems or comments...

PBIL Back to PBIL home page