(data stored in ACNUC7421 zone)

EMBL: CP000667.PE560

CP000667.PE560       Location/Qualifiers
FT   CDS             complement(633793..634263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53045"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E5"
FT                   /protein_id="ABP53045.1"
FT                   /translation="MQLTVGSFLVVCNVGAGAEVTVLRRGTAGFEVLSTLADPAAGGTA
FT                   IDDAITAALTAHNGSHDGDSARWVLAASVRAAKHAPADRAAVTMTLPDNSATVLTVGLL
FT                   DQTARPVLRRVVHLMSEAIAAAEISVHDLTGTTRQAIEAAVAEARRLGSSGN"
     MQLTVGSFLV VCNVGAGAEV TVLRRGTAGF EVLSTLADPA AGGTAIDDAI TAALTAHNGS        60
     HDGDSARWVL AASVRAAKHA PADRAAVTMT LPDNSATVLT VGLLDQTARP VLRRVVHLMS       120
     EAIAAAEISV HDLTGTTRQA IEAAVAEARR LGSSGN                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page