(data stored in ACNUC7421 zone)

EMBL: CP000667.PE563

CP000667.PE563       Location/Qualifiers
FT   CDS             637247..638563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53048"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E8"
FT                   /protein_id="ABP53048.1"
FT                   /translation="MSARNLYSVAPSAARLTDSLRDIGYDFPTAVADVVDNSVAAGANR
FT                   VEIDIVFDGFDSWVMIADDGEGMSANGLLEALRYGSRRDYGRGDLGRYGLGLKTASLSQ
FT                   CRSLTVVSRRRAATARTVSRMIDLDLIAEVDDWVVAEPANDERVVKARETVADTGGTVV
FT                   LWRGLDRVLPERKPEGGWARRRLEALAGRTADHLGTVFHRFLEGEVGDGLVITVNGEKV
FT                   QPWNPFAPDEPSREVLPPLRFEVTVGEATGTVSLQRYVLPSRDQFSSQAEFERLSGPLN
FT                   WNRQQGLYVYRAQRLVQWGGWNGMRGIDEHTKLARAALDFDTDLDVVFNINVAKIRVAM
FT                   PPQLRQLLERPVHELCMRADDAYRKNSRGASEGAEVASEQLAALSRSEASGATPPMPVV
FT                   GLALRAAAMRAGEYAALQRIGERLRAEAPDVAAALGFRD"
     MSARNLYSVA PSAARLTDSL RDIGYDFPTA VADVVDNSVA AGANRVEIDI VFDGFDSWVM        60
     IADDGEGMSA NGLLEALRYG SRRDYGRGDL GRYGLGLKTA SLSQCRSLTV VSRRRAATAR       120
     TVSRMIDLDL IAEVDDWVVA EPANDERVVK ARETVADTGG TVVLWRGLDR VLPERKPEGG       180
     WARRRLEALA GRTADHLGTV FHRFLEGEVG DGLVITVNGE KVQPWNPFAP DEPSREVLPP       240
     LRFEVTVGEA TGTVSLQRYV LPSRDQFSSQ AEFERLSGPL NWNRQQGLYV YRAQRLVQWG       300
     GWNGMRGIDE HTKLARAALD FDTDLDVVFN INVAKIRVAM PPQLRQLLER PVHELCMRAD       360
     DAYRKNSRGA SEGAEVASEQ LAALSRSEAS GATPPMPVVG LALRAAAMRA GEYAALQRIG       420
     ERLRAEAPDV AAALGFRD                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page