(data stored in ACNUC7421 zone)

EMBL: CP000667.PE572

CP000667.PE572       Location/Qualifiers
FT   CDS             650976..651596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53057"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2F7"
FT                   /protein_id="ABP53057.1"
FT                   /translation="MPGLGAADRYGFALAGGYAVQAAGLLERPSEDLDLFTAWDRRNEF
FT                   TAAVTAVVHVYRDDSLTVETKRQYDTFARLAVTDGIRASKVELRVDWRANEPILMAIGP
FT                   VPHPDDAVANKMSALYGRAFARDFIDLDATLRSGRYTHDALLALARRADRGFDPRTFAD
FT                   ALGQATQLDPDDFAQYGVTGPVLDNLRGRFAEWRRELLDDEKG"
     MPGLGAADRY GFALAGGYAV QAAGLLERPS EDLDLFTAWD RRNEFTAAVT AVVHVYRDDS        60
     LTVETKRQYD TFARLAVTDG IRASKVELRV DWRANEPILM AIGPVPHPDD AVANKMSALY       120
     GRAFARDFID LDATLRSGRY THDALLALAR RADRGFDPRT FADALGQATQ LDPDDFAQYG       180
     VTGPVLDNLR GRFAEWRREL LDDEKG                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page