(data stored in ACNUC7421 zone)

EMBL: CP000667.PE573

CP000667.PE573       Location/Qualifiers
FT   CDS             complement(652216..652371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53058"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2F8"
FT                   /protein_id="ABP53058.1"
FT                   /translation="MTCYVAGYTGELAAANEIAELAWLTMRDRERVSPVDKMIFAHLHE
FT                   AHLLRD"
     MTCYVAGYTG ELAAANEIAE LAWLTMRDRE RVSPVDKMIF AHLHEAHLLR D                 51
//

If you have problems or comments...

PBIL Back to PBIL home page